PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00023.152
Common NameAMTR_s00023p00208940, LOC18423601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 470aa    MW: 51749.8 Da    PI: 9.7072
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00023.152genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.54.8e-32193248359
                                               -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                               DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  ++++ ei+Y+geHnh 
  evm_27.model.AmTr_v1.0_scaffold00023.152 193 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-NGQIAEIVYKGEHNHV 248
                                               9***************************************.***************6 PP

2WRKY103.98.6e-33388445259
                                               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                               +Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k+ver+++dp++++ tYeg+Hnh+
  evm_27.model.AmTr_v1.0_scaffold00023.152 388 EDGFRWRKYGQKVVKGNPYPRSYYRCTSLRCNVRKHVERASNDPRAFISTYEGKHNHD 445
                                               8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-28183250IPR003657WRKY domain
SuperFamilySSF1182909.29E-25187250IPR003657WRKY domain
SMARTSM007741.4E-35191249IPR003657WRKY domain
PROSITE profilePS5081123.135193250IPR003657WRKY domain
PfamPF031067.7E-25193247IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-33377447IPR003657WRKY domain
SuperFamilySSF1182903.92E-28380447IPR003657WRKY domain
PROSITE profilePS5081135.818382447IPR003657WRKY domain
SMARTSM007742.3E-38387446IPR003657WRKY domain
PfamPF031062.1E-25388445IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MEDRVVERPA AVARPVATRP SCSGFGSFSK LLAGAINASP PRSCAEATVA IRPKTVRFKP  60
PLNQIPGWLP SSQGEIPMPQ ASGSSVKVSK PESRSSVIYK PMAKLVSRTT AAFLPNLGNF  120
KTSHQQALRQ AQSQLQAQPQ AQTLNPLKVQ IHAQPTSPFP HQRSIVPMET NPPNDLVRES  180
SQSHEHNQKP SYDGYNWRKY GQKQVKGSEY PRSYYKCTHP NCPVKKKVER SFNGQIAEIV  240
YKGEHNHVKP QPPKRASSGL PIEASMIEGA ARETSGHLWD SSGDRTKGFD AGLLENQNDM  300
DISGNQVYNH GKSAFPNEPL TGVVGSPDNS CGMSEDCEEG TRGEDRDGEE PNNKRRKTEN  360
KGKEVSATLG GDHDPHVVVK TSESEILEDG FRWRKYGQKV VKGNPYPRSY YRCTSLRCNV  420
RKHVERASND PRAFISTYEG KHNHDMPLSQ TAGPSAMDAT SQPSNKTNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-33193447877Probable WRKY transcription factor 4
2lex_A4e-33193447877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006828264.10.0PREDICTED: WRKY transcription factor 44 isoform X1
TrEMBLW1NKI10.0W1NKI1_AMBTC; Uncharacterized protein
STRINGVIT_08s0040g03070.t011e-158(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10259810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.15e-83WRKY family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]